PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042068t1
Common NameTCM_042068
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GATA
Protein Properties Length: 343aa    MW: 37043.3 Da    PI: 8.6703
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042068t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-18257291135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C +C +tkTp+WR+gp g+ktLCnaCG++yr+ +l
  Thecc1EG042068t1 257 CMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRL 291
                       99*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.9E-17251305IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.09E-14255314No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14255288IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.411255287IPR000679Zinc finger, GATA-type
CDDcd002028.75E-16256303No hitNo description
PfamPF003201.7E-16257291IPR000679Zinc finger, GATA-type
PROSITE patternPS003440257282IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MNNSWFDKTF NGVNDDFFDD VIKYLDFPLE DVEANDGSGG GSSGEDVIKD FHLPLEDSGG  60
GGGGEEWDCN FQNLEPPPAN VLAGLSSGFY GDFFGDNLAK NLTVSCDGSS QPNQQTSTTK  120
ASSSRSITLN SESADLKGSN RFQTSSPVSV LESSSSCSAA NPTPIDPNLS FPVKRSRSKR  180
RRVSTFNLHV SLPFISSTSS TSRGSNSLVG SESESESHLT EKSAKKRQKK KRNLTLLSGS  240
SEIKKSPSQQ PVVVRKCMHC EVTKTPQWRE GPMGPKTLCN ACGVRYRSGR LLPEYRPAAS  300
PTFVSSLHSN SHKKVVEMRK KAKLPISVMP SMLSIPPENS FG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174179RSRSKR
2178182KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016761.10.0GATA zinc finger protein regulating nitrogen assimilation, putative
TrEMBLA0A061GWZ30.0A0A061GWZ3_THECC; GATA zinc finger protein regulating nitrogen assimilation, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.23e-43GATA transcription factor 11
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]